PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015878004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 737aa    MW: 80599.6 Da    PI: 6.421
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015878004.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.51.3e-22214267155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k++++Wt+ LH+rF+ a+++    ekA+Pk+ile+m+v+gLt+e+v+SHLQkYR+
  XP_015878004.1 214 KAKVVWTNSLHNRFLLAIRHV-TLEKAVPKRILEFMNVPGLTRENVASHLQKYRI 267
                     6799*****************.9*******************************6 PP

2Response_reg78.72e-26251331109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     +l+vdD+ + + ++  +l+  +y +v +++++ +al++l+ k+  +D++++D+ mp m+G+el k+  ee  klp+i+++a ++e+ +l+ lk G
  XP_015878004.1  25 ILVVDDDATTLAIVSAMLRTMRY-QVVTVRNPVDALTTLRMKKglIDIVVTDLHMPYMNGFELQKKVDEEF-KLPVIMMSADDKESVILKGLKGG 117
                     89*********************.9999***********999999**********************9999.9********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     +  f++Kp++p++l +
  XP_015878004.1 118 VAYFIVKPVSPDDLKN 133
                     *************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004481.2E-2723135IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521726.83E-3123140IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.4E-3323177No hitNo description
PROSITE profilePS5011037.96724139IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.3E-2225133IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.90E-2626138No hitNo description
SuperFamilySSF466895.02E-17211271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-23212271IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-23214267IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MDRERVTIGQ SFEAGTKPPH VDIHILVVDD DATTLAIVSA MLRTMRYQVV TVRNPVDALT  60
TLRMKKGLID IVVTDLHMPY MNGFELQKKV DEEFKLPVIM MSADDKESVI LKGLKGGVAY  120
FIVKPVSPDD LKNVWQYAVA AKKGKSVVVE EIDKSFHDES SSSADQKISS EEINSETNTA  180
NEEKRGGKDH QRKAGKKCKG NQQNRQHKNV APKKAKVVWT NSLHNRFLLA IRHVTLEKAV  240
PKRILEFMNV PGLTRENVAS HLQKYRIFLK RVAEKGALTM KGSTSDKVSK SSFASGHSSM  300
QILKNVLQQQ QQMRITSPTI FQQGFRANNI SSPNSSNVGI FTTTTTNTVP NHGLFGHSNF  360
LGNQANIQHP ILGSTTTNPV CQPSFPGLGI NSNINNGKTS FINNGANQQQ YQARPENFIT  420
PSVLNQGFTS MQDYTSQGTK NNMGNLNANL VSNSCNPSTN FAGIQRNNNG GGLMGLDQSR  480
LNINGGGVSG GLFNNGYGLV NGICSDNMNS SVGSLGNDYG LGYLQAQGGS SSSSGGFDSG  540
IQALLFPNNI NHQQNALPQN YQSGFFSNHV NNGESNFGYK DGLINFNNTS TASHAQQSSL  600
ENDISDLILM GDTNLQPSLY HQQQDGGAND VASDLCDISC EARMNPSANQ VQIPDLPALY  660
PAPEIGPYQQ SLGQNQGNEQ VMNPEYGNST LHPTEVYNPC SDQYSYQKQG STEDLDCEFT  720
DMYQDWDDFM DSLLDAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-21211273264ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015878004.10.0PREDICTED: two-component response regulator ARR10
TrEMBLM5X7A71e-120M5X7A7_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101422534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.14e-53response regulator 2